| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334339.1 | 5prime_partial | 239 | 765-46(-) |
Amino Acid sequence : | |||
| GLLGLISNFDHLVDDLSEHFRNISERNTNRKRMRILMGESMGGAMVLRLHRKMPDFWDGAVLVAPMCKIADDMKPSPLVITILTALARVIPTWKLTPTPDIVDIAFRDPKVREEVRSNPY TYKGRPRLQTSYQLYTVSMDLEKRLEEVSLPFIVVHGEEDKVTDPSVSRLLYESARATDKTFKLYPGMWHSLSYGELPENLDIVFSDIVKWVDQRLDAKLEEQQKFANDQNALQSYSTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 11,452.455 | ||
| Theoretical pI: | 11.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.454 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.288 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334339.1 | 3prime_partial | 104 | 455-766(+) |
Amino Acid sequence : | |||
| MSTISGVGVSFHVGMTRAKAVKIVITNGLGFISSAILHMGATRTAPSQKSGIFLCNRRTIAPPIDSPINILILFRFVFLSEIFLKCSERSSTRWSKLEMRPSRP | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,452.455 | ||
| Theoretical pI: | 11.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.454 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.288 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334339.1 | 5prime_partial | 239 | 765-46(-) |
Amino Acid sequence : | |||
| GLLGLISNFDHLVDDLSEHFRNISERNTNRKRMRILMGESMGGAMVLRLHRKMPDFWDGAVLVAPMCKIADDMKPSPLVITILTALARVIPTWKLTPTPDIVDIAFRDPKVREEVRSNPY TYKGRPRLQTSYQLYTVSMDLEKRLEEVSLPFIVVHGEEDKVTDPSVSRLLYESARATDKTFKLYPGMWHSLSYGELPENLDIVFSDIVKWVDQRLDAKLEEQQKFANDQNALQSYSTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 11,452.455 | ||
| Theoretical pI: | 11.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.454 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.288 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334339.1 | 3prime_partial | 104 | 455-766(+) |
Amino Acid sequence : | |||
| MSTISGVGVSFHVGMTRAKAVKIVITNGLGFISSAILHMGATRTAPSQKSGIFLCNRRTIAPPIDSPINILILFRFVFLSEIFLKCSERSSTRWSKLEMRPSRP | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,452.455 | ||
| Theoretical pI: | 11.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.454 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.288 | ||
| sheet | 0.202 | ||