| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334346.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| VGGTNVCLRKFDAAAIYAAIRQHHVTHMCGAPVVLNMLTNVPDGKPLEKPVHILTAGAPPPAAVLFRTESLGFVVSHGYGLTETGGLVVCCSWKNKWNKFPAEERARLKSRQGVRTPGMA AIDVINEETGKSVKRDGKTLGEVVLRGGSVMLGYLKDPAGTAKAMKNGWFFTGDVGVMHPDGYMEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVARPDEFWGETPCAFLSLK EGV | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 24,165.389 | ||
| Theoretical pI: | 10.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 50.248 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.345 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334346.1 | 5prime_partial | 226 | 728-48(-) |
Amino Acid sequence : | |||
| TPSFRLRNAHGVSPQNSSGRATTAASFTAGWVYRTDSTSTLLRFSPPLMITSLDRSLISMYPSGCITPTSPVKNQPFFIAFAVPAGSFRYPSMTEPPLSTTSPRVFPSRFTLFPVSSLIT SIAAIPGVLTPCLDLSLALSSAGNLFHLFFHEQQTTRPPVSVSPYPWLTTNPSDSVRKSTAAGGGAPAVRMWTGFSNGFPSGTLVSILSTTGAPHMCVTWCWRIAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 24,165.389 | ||
| Theoretical pI: | 10.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 50.248 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.345 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334346.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| VGGTNVCLRKFDAAAIYAAIRQHHVTHMCGAPVVLNMLTNVPDGKPLEKPVHILTAGAPPPAAVLFRTESLGFVVSHGYGLTETGGLVVCCSWKNKWNKFPAEERARLKSRQGVRTPGMA AIDVINEETGKSVKRDGKTLGEVVLRGGSVMLGYLKDPAGTAKAMKNGWFFTGDVGVMHPDGYMEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVARPDEFWGETPCAFLSLK EGV | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 24,165.389 | ||
| Theoretical pI: | 10.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 50.248 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.345 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334346.1 | 5prime_partial | 226 | 728-48(-) |
Amino Acid sequence : | |||
| TPSFRLRNAHGVSPQNSSGRATTAASFTAGWVYRTDSTSTLLRFSPPLMITSLDRSLISMYPSGCITPTSPVKNQPFFIAFAVPAGSFRYPSMTEPPLSTTSPRVFPSRFTLFPVSSLIT SIAAIPGVLTPCLDLSLALSSAGNLFHLFFHEQQTTRPPVSVSPYPWLTTNPSDSVRKSTAAGGGAPAVRMWTGFSNGFPSGTLVSILSTTGAPHMCVTWCWRIAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 24,165.389 | ||
| Theoretical pI: | 10.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 50.248 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.345 | ||
| sheet | 0.199 | ||