| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334352.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| SLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEA VRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 20,883.873 | ||
| Theoretical pI: | 6.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 30.535 | ||
| aromaticity | 0.041 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.249 | ||
| sheet | 0.294 | ||