| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334355.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
| ICAPIMADTVDQMVELMHVAKVKGADIVEVRLDHLKSFEARPDIERLIRECPLPTLFTYRPIWEGGQYDGDENPRFKALQLAMELGADHIDIELKAADEFKNFMGGNKPEKCKVIVSSHN YEFTPSAEELGNLVARIQAAGADIVKFATTAQDITDVARVFQITVHSQVPIIAMVMGERGIMSRLLCPKFGGYLTFGTLVPGKVSAPGQPTIDELIRLYNFRSI | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,863.528 | ||
| Theoretical pI: | 5.427 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 30.173 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.192 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334355.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
| ICAPIMADTVDQMVELMHVAKVKGADIVEVRLDHLKSFEARPDIERLIRECPLPTLFTYRPIWEGGQYDGDENPRFKALQLAMELGADHIDIELKAADEFKNFMGGNKPEKCKVIVSSHN YEFTPSAEELGNLVARIQAAGADIVKFATTAQDITDVARVFQITVHSQVPIIAMVMGERGIMSRLLCPKFGGYLTFGTLVPGKVSAPGQPTIDELIRLYNFRSI | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 24,863.528 | ||
| Theoretical pI: | 5.427 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 30.173 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.192 | ||
| sheet | 0.277 | ||