Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334367.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
PSLNSYCFENLHNFSQRPCLIDGATGHVHTYEEVELTARKVATGLSKLGIQQGQTIMLLLPNSPQFVFAFLGASYIGAISTMANPYFTPAEVIKQATASAAKLIITQSCYIHKVQDYASR NQIKLMCVDAPPTGCLPFSDLTDSDERDMPAVKIHPDDAVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSEDVMLCVLPLFHIYSLNSVLLCGLRVGAAILLMHKFDMV PFLELMQKYKVTIGPVVPPIVLTIV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 21,368.855 | ||
Theoretical pI: | 10.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 46.966 | ||
aromaticity | 0.031 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.209 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334367.1 | 5prime_partial | 191 | 797-222(-) |
Amino Acid sequence : | |||
HDRQNYGRHYGPNRHFIFLHQLQKRNHVKFVHEQDGRPHPQPAQQHRIQRVDVEQRQHAQHHILAMNVQIRILPVDLLRHARHQPLVRQHHALGQPRRAGGIRQRHRVVGVDLHSWHVAL VGIRQIGEGKAACRRRVDAHELDLVARGVVLHLVDVAGLSDDELGSGGGGLLDDLGGGEVGIGHGGNGADV* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,368.855 | ||
Theoretical pI: | 10.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 46.966 | ||
aromaticity | 0.031 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.209 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334367.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
PSLNSYCFENLHNFSQRPCLIDGATGHVHTYEEVELTARKVATGLSKLGIQQGQTIMLLLPNSPQFVFAFLGASYIGAISTMANPYFTPAEVIKQATASAAKLIITQSCYIHKVQDYASR NQIKLMCVDAPPTGCLPFSDLTDSDERDMPAVKIHPDDAVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSEDVMLCVLPLFHIYSLNSVLLCGLRVGAAILLMHKFDMV PFLELMQKYKVTIGPVVPPIVLTIV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 21,368.855 | ||
Theoretical pI: | 10.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 46.966 | ||
aromaticity | 0.031 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.209 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334367.1 | 5prime_partial | 191 | 797-222(-) |
Amino Acid sequence : | |||
HDRQNYGRHYGPNRHFIFLHQLQKRNHVKFVHEQDGRPHPQPAQQHRIQRVDVEQRQHAQHHILAMNVQIRILPVDLLRHARHQPLVRQHHALGQPRRAGGIRQRHRVVGVDLHSWHVAL VGIRQIGEGKAACRRRVDAHELDLVARGVVLHLVDVAGLSDDELGSGGGGLLDDLGGGEVGIGHGGNGADV* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,368.855 | ||
Theoretical pI: | 10.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 46.966 | ||
aromaticity | 0.031 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.209 | ||
sheet | 0.204 |