| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334376.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| DAKAKQKALFRAKLNAQKKEKQKIDSPLVRYNEHDQPVCRVCDVVIKSESLWPAHQASRKHHEAIANLKASATSQNRPNNANSESSKDLPKPKSESSTVVNEKTEPSIALPTHRSSTLPP DFFDNQETKRQKTDTAPQKLANSNSVKDSVSAKNQLAEASDFGNETNLPYTATSTKMGKPDFRQASAPGSESKQVKGALPAGFFDDKDAELRARGITPVKPDVKDEYKEFERLIKEDLQE VDDRLEEREFDAAEMIEREEMV | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 14,102.708 | ||
| Theoretical pI: | 6.072 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.550 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.375 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334376.1 | 5prime_partial | 136 | 786-376(-) |
Amino Acid sequence : | |||
| TISSLSIISAASNSLSSNRSSTSCKSSLISLSNSLYSSFTSGLTGVIPRARNSASLSSKKPAGSAPLTCLDSEPGADACLKSGFPIFVDVAVYGKLVSFPKSEASASWFFADTESFTELE FASFWGAVSVFCLLVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,102.708 | ||
| Theoretical pI: | 6.072 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.550 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.375 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334376.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| DAKAKQKALFRAKLNAQKKEKQKIDSPLVRYNEHDQPVCRVCDVVIKSESLWPAHQASRKHHEAIANLKASATSQNRPNNANSESSKDLPKPKSESSTVVNEKTEPSIALPTHRSSTLPP DFFDNQETKRQKTDTAPQKLANSNSVKDSVSAKNQLAEASDFGNETNLPYTATSTKMGKPDFRQASAPGSESKQVKGALPAGFFDDKDAELRARGITPVKPDVKDEYKEFERLIKEDLQE VDDRLEEREFDAAEMIEREEMV | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 14,102.708 | ||
| Theoretical pI: | 6.072 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.550 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.375 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334376.1 | 5prime_partial | 136 | 786-376(-) |
Amino Acid sequence : | |||
| TISSLSIISAASNSLSSNRSSTSCKSSLISLSNSLYSSFTSGLTGVIPRARNSASLSSKKPAGSAPLTCLDSEPGADACLKSGFPIFVDVAVYGKLVSFPKSEASASWFFADTESFTELE FASFWGAVSVFCLLVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,102.708 | ||
| Theoretical pI: | 6.072 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.550 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.375 | ||
| sheet | 0.243 | ||