| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334379.1 | complete | 147 | 76-519(+) |
Amino Acid sequence : | |||
| MKSNKLQIQTRAKPQGTTFDSNKRHLQVHSYTLEKIGGQSRSRPPLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQKVSYHKCHQIYTQLGTRAHSSSRTKWKKSKIGPFHVNILFQ KSLRPKLKRVLPHSRITGYRPHIDMHI* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 14,586.504 | ||
| Theoretical pI: | 10.060 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 36.725 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.403 | ||
| sheet | 0.165 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334379.1 | complete | 139 | 257-676(+) |
Amino Acid sequence : | |||
| MSNSSGLTPLGGAQLKWCKRCPIINVTKFIPSWAPGHTLLPAPNGKSQKSGPFMSTSSSKNLSGLNSKGFFHTAGSRATAHTLTCTFDPLGISNPPIFTFEFDRGGSISGVGGCNLSASL ATHCKKGRFEKSNSVIPRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,586.504 | ||
| Theoretical pI: | 10.060 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 36.725 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.403 | ||
| sheet | 0.165 | ||