Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334379.1	complete	147	76-519(+)
Amino Acid sequence :
MKSNKLQIQTRAKPQGTTFDSNKRHLQVHSYTLEKIGGQSRSRPPLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQKVSYHKCHQIYTQLGTRAHSSSRTKWKKSKIGPFHVNILFQ KSLRPKLKRVLPHSRITGYRPHIDMHI*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		14,586.504
Theoretical pI:		10.060
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		36.725
aromaticity		0.079
GRAVY		-0.229
Secondary Structure Fraction
Helix		0.230
turn		0.403
sheet		0.165

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334379.1	complete	139	257-676(+)
Amino Acid sequence :
MSNSSGLTPLGGAQLKWCKRCPIINVTKFIPSWAPGHTLLPAPNGKSQKSGPFMSTSSSKNLSGLNSKGFFHTAGSRATAHTLTCTFDPLGISNPPIFTFEFDRGGSISGVGGCNLSASL ATHCKKGRFEKSNSVIPRS*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		14,586.504
Theoretical pI:		10.060
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		36.725
aromaticity		0.079
GRAVY		-0.229
Secondary Structure Fraction
Helix		0.230
turn		0.403
sheet		0.165