| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334390.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| PQPLAAAGGGAGSRFYDFGRPKLRLTSEYDSDSSVFFHKVSCKLMDNLAKLKFAFYNNNKGEVSEPQISFNSKFFSLQYDVEENDALLKTSFEIVPGVQLRAAHQVKSRQGEVAMVADLA TPAYKLELASAVPSVGMPKATFKFPLGEVSLVDKEVEEEEEIQKKTLAVSGIVKSNILNGVCTARYDEDNLDLRYAFKDEQMTLIPSISLPSNAFSCAFKRRFTPWDKLSYLYHFDSNNW SAVYKHTIGKGYKFXAG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,591.104 | ||
| Theoretical pI: | 7.311 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 48.150 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.246 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334390.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| PQPLAAAGGGAGSRFYDFGRPKLRLTSEYDSDSSVFFHKVSCKLMDNLAKLKFAFYNNNKGEVSEPQISFNSKFFSLQYDVEENDALLKTSFEIVPGVQLRAAHQVKSRQGEVAMVADLA TPAYKLELASAVPSVGMPKATFKFPLGEVSLVDKEVEEEEEIQKKTLAVSGIVKSNILNGVCTARYDEDNLDLRYAFKDEQMTLIPSISLPSNAFSCAFKRRFTPWDKLSYLYHFDSNNW SAVYKHTIGKGYKFXAG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,591.104 | ||
| Theoretical pI: | 7.311 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 48.150 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.246 | ||
| sheet | 0.262 | ||