| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334392.1 | complete | 233 | 61-762(+) |
Amino Acid sequence : | |||
| MAAAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 24,395.442 | ||
| Theoretical pI: | 6.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12170 | ||
| Instability index: | 34.913 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.313 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334392.1 | complete | 233 | 61-762(+) |
Amino Acid sequence : | |||
| MAAAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 24,395.442 | ||
| Theoretical pI: | 6.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12170 | ||
| Instability index: | 34.913 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.313 | ||
| sheet | 0.232 | ||