| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334394.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| ELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQ LVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTPIHIFVGDTRQPRNENMGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENG KLVRVSVKDTIDNRKMG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 29,298.806 | ||
| Theoretical pI: | 6.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 39.750 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.280 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334394.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| ELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQ LVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTPIHIFVGDTRQPRNENMGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENG KLVRVSVKDTIDNRKMG | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 29,298.806 | ||
| Theoretical pI: | 6.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 39.750 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.280 | ||
| sheet | 0.179 | ||