| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334405.1 | internal | 222 | 3-668(+) |
Amino Acid sequence : | |||
| GKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDAFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLNLLRAFATGGYAA MQRVTQWNLDFVEHSEQGDRYQELAHRVDEALGFMEAAGLTIDHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTXQLDGAHVEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,715.614 | ||
| Theoretical pI: | 5.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 32.899 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.213 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334405.1 | internal | 222 | 3-668(+) |
Amino Acid sequence : | |||
| GKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDAFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLNLLRAFATGGYAA MQRVTQWNLDFVEHSEQGDRYQELAHRVDEALGFMEAAGLTIDHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTXQLDGAHVEFL | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,715.614 | ||
| Theoretical pI: | 5.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 32.899 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.213 | ||
| sheet | 0.290 | ||