| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334413.1 | 3prime_partial | 259 | 45-821(+) |
Amino Acid sequence : | |||
| MEYEGILLGMGNPLLDISAVVDQQFLDKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCA VCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIA LKISQWPKASGTHKRITVI | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,974.795 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
| Instability index: | 34.875 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.212 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334413.1 | 3prime_partial | 259 | 45-821(+) |
Amino Acid sequence : | |||
| MEYEGILLGMGNPLLDISAVVDQQFLDKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCA VCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIA LKISQWPKASGTHKRITVI | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,974.795 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
| Instability index: | 34.875 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.212 | ||
| sheet | 0.293 | ||