| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334417.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| QKTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQG VEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSR LAQSFDYTTAISSPC | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,071.569 | ||
| Theoretical pI: | 9.402 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 51.436 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.235 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334417.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| QKTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQG VEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSR LAQSFDYTTAISSPC | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,071.569 | ||
| Theoretical pI: | 9.402 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 51.436 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.235 | ||
| sheet | 0.251 | ||