Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334423.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
HAGFRYSWRREHKTPKKGNSMAGMVEFVGLIHVNIVRGTDLAIRDMVSSDPYVILTLGSQSMKTRVIKNNLNPVWNEKLMLSIPEDMPPLKLLVYDKDTFSTDDFMGSAEIDIQPLVTAA KATEVSSVNEPMQLGNWKASKDENILVKDGPITLEDGKVKQEISIKLQNVERGILEVELECVPLTQ* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,836.815 | ||
Theoretical pI: | 5.460 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 37.698 | ||
aromaticity | 0.054 | ||
GRAVY | -0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.237 | ||
sheet | 0.258 |