| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334424.1 | 5prime_partial | 186 | 616-56(-) |
Amino Acid sequence : | |||
| ARGFRYSWRREHKTPKKGNSMAGMVEFVGLIHVNIVRGTDLAIRDMVWSDPYVILTLGSQSMKTRVIKNNLNPVWNEKLMLSIPEDMPPLKLLVYDKDTFLTDDFMGSAEIDIQPLVTAA KATEVSSVNEPMQLGNWKASKDEIILVKDGPITLEVGKVKQEIFIKLQNVERGILEVELECVPLTQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 21,024.269 | ||
| Theoretical pI: | 5.794 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26470 | ||
| Instability index: | 33.388 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.215 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334424.1 | 5prime_partial | 186 | 616-56(-) |
Amino Acid sequence : | |||
| ARGFRYSWRREHKTPKKGNSMAGMVEFVGLIHVNIVRGTDLAIRDMVWSDPYVILTLGSQSMKTRVIKNNLNPVWNEKLMLSIPEDMPPLKLLVYDKDTFLTDDFMGSAEIDIQPLVTAA KATEVSSVNEPMQLGNWKASKDEIILVKDGPITLEVGKVKQEIFIKLQNVERGILEVELECVPLTQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 21,024.269 | ||
| Theoretical pI: | 5.794 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26470 | ||
| Instability index: | 33.388 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.215 | ||
| sheet | 0.263 | ||