Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334431.1	complete	189	78-647(+)
Amino Acid sequence :
MCLHVSAEIDQDRDIINLKPCTRECGNFSYAICPRSEGSPRTPICTTCCAGYKGCKYYNANGTFICEGQSDPRKPNERCPKECDRKIAYSKCPRSEGPTIIKPTGCTTCCTGYKGCYYYG KDNKFVCEGQSNEPKVCTQQCDLKVAYMTCPPESTKLTRVCVNCCTAKPGCKLYGHDGSLICIGGVKPL*
Physicochemical properties
Number of amino acids:		189
Molecular weight:		20,761.822
Theoretical pI:		8.514
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16390 17890
Instability index:		44.304
aromaticity		0.074
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.206
turn		0.265
sheet		0.138