Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334435.1 | complete | 113 | 141-482(+) |
Amino Acid sequence : | |||
MSDFNSQIPTAFDPFADANADNSGAGAKDYVHIRTQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKDHIKIHGF* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,541.070 | ||
Theoretical pI: | 9.171 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 21.942 | ||
aromaticity | 0.080 | ||
GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.221 | ||
sheet | 0.168 |