| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334435.1 | complete | 113 | 141-482(+) |
Amino Acid sequence : | |||
| MSDFNSQIPTAFDPFADANADNSGAGAKDYVHIRTQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKDHIKIHGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,541.070 | ||
| Theoretical pI: | 9.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 21.942 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.221 | ||
| sheet | 0.168 | ||