Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334436.1 | complete | 136 | 117-527(+) |
Amino Acid sequence : | |||
MITIRTDRVLGGGGLHLLLQTRFMSDFNSQIPTAFDPFADANADNSGAGAKDYVHIRTQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCKGTVVQDPELGQVIQLQGDQRKNVSAFL VQAGIVKKDHIKIHGF* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,105.174 | ||
Theoretical pI: | 9.613 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 24.968 | ||
aromaticity | 0.074 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.206 | ||
sheet | 0.184 |