Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334449.1 | complete | 145 | 169-606(+) |
Amino Acid sequence : | |||
MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCEGLWPIFKIAHQKSRYVFDLYHRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCMQPRDHNFQTTCVCR VPRHLREEKVIECVHCGCNGCASGD* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 17,243.797 | ||
Theoretical pI: | 8.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 26065 | ||
Instability index: | 47.261 | ||
aromaticity | 0.090 | ||
GRAVY | -0.852 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.166 | ||
sheet | 0.234 |