Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334450.1	5prime_partial	199	1-600(+)
Amino Acid sequence :
RLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVD FVGGDMFESLPKADAVMLMVSFVLPMEILCYTMVLHSLDVGRLKYCGGPGQIGENLVFKYIEVFDSNFVKNINYITIIF*
Physicochemical properties
Number of amino acids:		199
Molecular weight:		21,663.939
Theoretical pI:		7.084
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		23.233
aromaticity		0.106
GRAVY		0.226
Secondary Structure Fraction
Helix		0.342
turn		0.246
sheet		0.261