| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334452.1 | 3prime_partial | 221 | 158-820(+) |
Amino Acid sequence : | |||
| MPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFS SDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCHQQEYEYA | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 12,064.029 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.190 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334452.1 | 5prime_partial | 105 | 820-503(-) |
Amino Acid sequence : | |||
| SILILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,064.029 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.190 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334452.1 | 3prime_partial | 221 | 158-820(+) |
Amino Acid sequence : | |||
| MPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFS SDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCHQQEYEYA | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 12,064.029 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.190 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334452.1 | 5prime_partial | 105 | 820-503(-) |
Amino Acid sequence : | |||
| SILILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,064.029 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.190 | ||
| sheet | 0.248 | ||