Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334455.1 | 5prime_partial | 263 | 1-792(+) |
Amino Acid sequence : | |||
ARTVSPHAAELPTIWQNEIQQFVRLKMGSEGTEIGGSRKLRLLCLHGFRTSGEIIRKQVTGKWPESVLEKLDLVFVDAPFPAQGKSDVEGIFDPPYYEWFKFDKEFKEYINFDECLAYIE ECMINNGPFDGLLGFSQGAILSAALAGMQAKGLALTRVPKLKLIVIIGGAKFRNPSVAEKAYSSPIQCRSVHFLGDQDFLKQHGTELLDSYVDPVVIRHPKGHTIPRFDEKGLESMLAFL EDLQKHVEDEKKEISFENHVMEL* | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 29,683.748 | ||
Theoretical pI: | 5.677 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
Instability index: | 40.189 | ||
aromaticity | 0.099 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.213 | ||
sheet | 0.274 |