| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334468.1 | internal | 262 | 1-786(+) |
Amino Acid sequence : | |||
| ARRVNIKTKLEEEEKENLLKLQQEEEELQLQKLKKRKIKADPRLSFADEFENDNEEEDEENQHEDPQGVIRRRFGKYGKDPTVETSFLPDSEREAEEQAERERLRKQWLLEQEQIKNEPL EITYSYWDGTGHRRVIQVRKGDSIGEFLRAVQQQLAPEFREVRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHEDVRTIADATIEKDESHAGKVVERHWYEKNKHIF PASRWEIYDPTKKWERYTIHGD | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 31,348.481 | ||
| Theoretical pI: | 5.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
| Instability index: | 59.265 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.153 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334468.1 | internal | 262 | 1-786(+) |
Amino Acid sequence : | |||
| ARRVNIKTKLEEEEKENLLKLQQEEEELQLQKLKKRKIKADPRLSFADEFENDNEEEDEENQHEDPQGVIRRRFGKYGKDPTVETSFLPDSEREAEEQAERERLRKQWLLEQEQIKNEPL EITYSYWDGTGHRRVIQVRKGDSIGEFLRAVQQQLAPEFREVRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHEDVRTIADATIEKDESHAGKVVERHWYEKNKHIF PASRWEIYDPTKKWERYTIHGD | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 31,348.481 | ||
| Theoretical pI: | 5.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
| Instability index: | 59.265 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.153 | ||
| sheet | 0.279 | ||