| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334491.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
| RKATRTSRGCCFVICPSREEADKAIDACHNKKTLPGASSPLQVKYADGELERLEHKLFIGMLPKNISDDEVSALFSNYGTITDLQLLRGYQQTSKGCAFLKFETKEQALAAIEALNGKHK IEGSTVPLVVKWADTEKERQARRAQKALSLASTVPNPDSRQHLYGALPMSYISPYNGYGYQTPGTYGLMHYRLPPLQNQHAYQNLISPLNQGNAIRGVPPDLSSGMAPRNYAVSSTNYVG SAYPAVHGVQYPMTYPGGMMSNRPPGYSIGFRFSLSF | |||
Physicochemical properties | |||
| Number of amino acids: | 277 | ||
| Molecular weight: | 30,503.313 | ||
| Theoretical pI: | 9.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30830 31080 | ||
| Instability index: | 47.937 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.292 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334491.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
| RKATRTSRGCCFVICPSREEADKAIDACHNKKTLPGASSPLQVKYADGELERLEHKLFIGMLPKNISDDEVSALFSNYGTITDLQLLRGYQQTSKGCAFLKFETKEQALAAIEALNGKHK IEGSTVPLVVKWADTEKERQARRAQKALSLASTVPNPDSRQHLYGALPMSYISPYNGYGYQTPGTYGLMHYRLPPLQNQHAYQNLISPLNQGNAIRGVPPDLSSGMAPRNYAVSSTNYVG SAYPAVHGVQYPMTYPGGMMSNRPPGYSIGFRFSLSF | |||
Physicochemical properties | |||
| Number of amino acids: | 277 | ||
| Molecular weight: | 30,503.313 | ||
| Theoretical pI: | 9.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30830 31080 | ||
| Instability index: | 47.937 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.292 | ||
| sheet | 0.245 | ||