Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334498.1 | 5prime_partial | 163 | 707-216(-) |
Amino Acid sequence : | |||
NRWWMWAAATERLSGDWWRRFRGCGELRLICRRLWRMSPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDNKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMTM LAVMAQGKERTYKEWVHLLNEAGFSKPTVKNIKFIESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 14,730.535 | ||
Theoretical pI: | 10.839 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 76.160 | ||
aromaticity | 0.145 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.242 | ||
sheet | 0.145 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334498.1 | complete | 124 | 297-671(+) |
Amino Acid sequence : | |||
MHPFLISSLLSLRHHRQHCHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRRHPPQSPANQTQFPAPTETPP PVSR* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,730.535 | ||
Theoretical pI: | 10.839 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 76.160 | ||
aromaticity | 0.145 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.242 | ||
sheet | 0.145 |