| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334502.1 | complete | 181 | 134-679(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPNYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 18,768.978 | ||
| Theoretical pI: | 5.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 40.548 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334502.1 | 5prime_partial | 168 | 791-285(-) |
Amino Acid sequence : | |||
| EIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSK AEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,768.978 | ||
| Theoretical pI: | 5.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 40.548 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.185 | ||
| sheet | 0.238 | ||