| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334516.1 | 3prime_partial | 228 | 203-886(+) |
Amino Acid sequence : | |||
| MGNGAKVILTSHLGRPKGVTPKYSLKPLVPRLSELLGLEVKMANDCIGEEVEKLVAGLPDGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKYLKPSVA GYLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKISVIESLLAKVDILLLGGGMIFTFYKAQGHSVGSSLVEADKLDLCTSLIEKAKAKGVSLLLPSDVVIADKFAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 24,256.015 | ||
| Theoretical pI: | 7.703 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 23.754 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.232 | ||
| sheet | 0.325 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334516.1 | 3prime_partial | 228 | 203-886(+) |
Amino Acid sequence : | |||
| MGNGAKVILTSHLGRPKGVTPKYSLKPLVPRLSELLGLEVKMANDCIGEEVEKLVAGLPDGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKYLKPSVA GYLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKISVIESLLAKVDILLLGGGMIFTFYKAQGHSVGSSLVEADKLDLCTSLIEKAKAKGVSLLLPSDVVIADKFAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 24,256.015 | ||
| Theoretical pI: | 7.703 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 23.754 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.232 | ||
| sheet | 0.325 | ||