Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334518.1 | complete | 119 | 25-384(+) |
Amino Acid sequence : | |||
MKGDYHRSLAEFKVGDERKEAAENTMLAYKAAQDIALADLPPTHPIRLGLALNFSVFYYEILNSPEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDQIDEV* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,463.059 | ||
Theoretical pI: | 4.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 40.930 | ||
aromaticity | 0.084 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.160 | ||
sheet | 0.387 |