Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334523.1 | complete | 194 | 148-732(+) |
Amino Acid sequence : | |||
MEGVGGDGPSAAAAALDQRRHELSKLFQHYLDKSTPHAHYRWIGTLGLVLLYALRVYYVQGFYIVTYGLGIYLLNLLIGFLSPLVDPELDPTDGPSLPTKGSDEFKPFIRRLPEFKFWYA ITKAFCVAFVMTFFSMFDVPVFWPILLCYWLVLLFLTMKRQIMHMIKYKYIPFNLGKQKYGGKKPSSSGSSPRD* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 22,237.891 | ||
Theoretical pI: | 9.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41495 | ||
Instability index: | 47.235 | ||
aromaticity | 0.165 | ||
GRAVY | 0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.407 | ||
turn | 0.227 | ||
sheet | 0.242 |