| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334524.1 | internal | 135 | 406-2(-) |
Amino Acid sequence : | |||
| RKIRIGGDSRRDGAERVGERRRRRRRRLRSIVNVHVLRHLQAGKLRLIIHRLPENMRSGGICDGICDGICDGKRDLKLRRRPLVMERVRRLSEIERDRRKRRRGGDRGHVGGAREDCSKE EIRVHDSVGGGLIGV | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 13,108.543 | ||
| Theoretical pI: | 5.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.336 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334524.1 | 3prime_partial | 125 | 32-406(+) |
Amino Acid sequence : | |||
| MNPNFLFRTILPCSSNMATISASAPFPTVTLDLTQSPNALHYQRPPPQFQVPFAVANSVTNSVANPAAPHVFGQAVYNQSKFSGLQMSKDVNVNDGAQPSAAAPPSFADTLSAVTAAITA DPNFT | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,108.543 | ||
| Theoretical pI: | 5.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.336 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334524.1 | internal | 135 | 406-2(-) |
Amino Acid sequence : | |||
| RKIRIGGDSRRDGAERVGERRRRRRRRLRSIVNVHVLRHLQAGKLRLIIHRLPENMRSGGICDGICDGICDGKRDLKLRRRPLVMERVRRLSEIERDRRKRRRGGDRGHVGGAREDCSKE EIRVHDSVGGGLIGV | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 13,108.543 | ||
| Theoretical pI: | 5.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.336 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334524.1 | 3prime_partial | 125 | 32-406(+) |
Amino Acid sequence : | |||
| MNPNFLFRTILPCSSNMATISASAPFPTVTLDLTQSPNALHYQRPPPQFQVPFAVANSVTNSVANPAAPHVFGQAVYNQSKFSGLQMSKDVNVNDGAQPSAAAPPSFADTLSAVTAAITA DPNFT | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,108.543 | ||
| Theoretical pI: | 5.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.336 | ||
| sheet | 0.232 | ||