| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334538.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| XLRRLPSLPSLSSSRYVSSFANQAAACNDSSRVTWIKQLNASLEEVDPEVADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYSGARYYGGNEYIDMAERLCQKRALET FRLDPEKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYD | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,320.294 | ||
| Theoretical pI: | 5.870 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
| Instability index: | 36.058 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.248 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334538.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| XLRRLPSLPSLSSSRYVSSFANQAAACNDSSRVTWIKQLNASLEEVDPEVADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYSGARYYGGNEYIDMAERLCQKRALET FRLDPEKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYD | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,320.294 | ||
| Theoretical pI: | 5.870 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
| Instability index: | 36.058 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.248 | ||
| sheet | 0.283 | ||