Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334539.1 | 5prime_partial | 213 | 826-185(-) |
Amino Acid sequence : | |||
EINKQGQEEKYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQAMTPEYKAYQEQVLSNCSKFAEALLERGYDLVSGGTENHLVLVNLRKKGIDGSRVEKVLEAVHIAANKNTVPGDVSA MVPGGIRMGTPALTSRGFTEEDFVKVAEFFDAAVNLALKIKADANGTKLKDFVSSMTSDIHQSALFKLRLEVEDYAKQFPTIGFQKETMKYKD* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 11,687.391 | ||
Theoretical pI: | 9.894 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.463 | ||
aromaticity | 0.111 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.278 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334539.1 | complete | 108 | 288-614(+) |
Amino Acid sequence : | |||
MSDVIDETKSFNLVPFASAFIFRAKFTAASKNSATLTKSSSVNPLDVRAGVPIRMPPGTMADTSPGTVFLLAAMCTASKTFSTLDPSIPFFLKFTKTRWFSVPPDTRS* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,687.391 | ||
Theoretical pI: | 9.894 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.463 | ||
aromaticity | 0.111 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.278 | ||
sheet | 0.213 |