| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334541.1 | 5prime_partial | 205 | 740-123(-) |
Amino Acid sequence : | |||
| DSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDDKVFVLVATNTPYAFDQAIRRRFDKRIYIPLPDVKARQHMFKVHLGDTPHNLTESDFEALARKTEGFSGSDISVCVKDVLFEPVRK TQDAMFFIKTFNGPWMPCGPKQQGAVQITMQELAAKGLAEKIIPPPISKTDFDKVLARQRPPVSKSDFDVHERFPKEFGEEGCQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 17,340.952 | ||
| Theoretical pI: | 9.898 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
| Instability index: | 58.380 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.350 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334541.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
| NRGGTFKNLNLPHLMRLIFECSKKHNVQRSPAAKSQQTKPSHGWQPSSPNSFGNLSCTSKSDLLTGGLCLASTLSKSVFDIGGGMIFSASPFAASSCMVIWTAPCCLGPHGIHGPLKVLM KNIASCVLRTGSNKTSLTQTEISEPEKPSVLRARASKSLSVKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,340.952 | ||
| Theoretical pI: | 9.898 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
| Instability index: | 58.380 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.350 | ||
| sheet | 0.221 | ||