Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334541.1 | 5prime_partial | 205 | 740-123(-) |
Amino Acid sequence : | |||
DSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDDKVFVLVATNTPYAFDQAIRRRFDKRIYIPLPDVKARQHMFKVHLGDTPHNLTESDFEALARKTEGFSGSDISVCVKDVLFEPVRK TQDAMFFIKTFNGPWMPCGPKQQGAVQITMQELAAKGLAEKIIPPPISKTDFDKVLARQRPPVSKSDFDVHERFPKEFGEEGCQP* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 17,340.952 | ||
Theoretical pI: | 9.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 58.380 | ||
aromaticity | 0.049 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.350 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334541.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
NRGGTFKNLNLPHLMRLIFECSKKHNVQRSPAAKSQQTKPSHGWQPSSPNSFGNLSCTSKSDLLTGGLCLASTLSKSVFDIGGGMIFSASPFAASSCMVIWTAPCCLGPHGIHGPLKVLM KNIASCVLRTGSNKTSLTQTEISEPEKPSVLRARASKSLSVKL* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,340.952 | ||
Theoretical pI: | 9.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 58.380 | ||
aromaticity | 0.049 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.350 | ||
sheet | 0.221 |