| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334550.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
| ARPYNDLPFMDNDDLRPGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGA SEEEVEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAAPLIALADYIAYRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 12,257.055 | ||
| Theoretical pI: | 11.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 64.450 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.444 | ||
| sheet | 0.145 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334550.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| TPVQRPTLHGQRRPPPWEAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQFGGDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSE RGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,257.055 | ||
| Theoretical pI: | 11.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 64.450 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.444 | ||
| sheet | 0.145 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334550.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
| ARPYNDLPFMDNDDLRPGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGA SEEEVEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAAPLIALADYIAYRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 12,257.055 | ||
| Theoretical pI: | 11.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 64.450 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.444 | ||
| sheet | 0.145 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334550.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| TPVQRPTLHGQRRPPPWEAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQFGGDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSE RGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,257.055 | ||
| Theoretical pI: | 11.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 64.450 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.444 | ||
| sheet | 0.145 | ||