| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334551.1 | internal | 182 | 547-2(-) |
Amino Acid sequence : | |||
| APEKMLRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIPPLKTAALVQASVVLGAVVGGASEAPPEKLRGFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAGDKATYPKL IGLEKSRELADKLNREAKEQLFPFDPHRAAPLIVLADYIAYRDYCPIFYYFSTNILILKRAK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,482.366 | ||
| Theoretical pI: | 5.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 33.877 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.214 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334551.1 | internal | 182 | 547-2(-) |
Amino Acid sequence : | |||
| APEKMLRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIPPLKTAALVQASVVLGAVVGGASEAPPEKLRGFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAGDKATYPKL IGLEKSRELADKLNREAKEQLFPFDPHRAAPLIVLADYIAYRDYCPIFYYFSTNILILKRAK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,482.366 | ||
| Theoretical pI: | 5.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 33.877 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.214 | ||
| sheet | 0.341 | ||