| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | 3prime_partial | 228 | 100-783(+) |
Amino Acid sequence : | |||
| MNFEDENFELREIQRLDGHTDKVWSVAWKPATGINGVPAVFASCSGDKTVRIWEEDSKGSFQCQAVLEETHTRTVRSCAWSPSGKFLATASFDATTAIWENVGVDFECVSTLEGHDNEVK SVSWNNSGSLLATCGRDKSVWIWEVLPGNEFDCVSVLQGHTQDVKMVQWNPSMDTLFSCSYDNTIKVWVEDGDSDDWHCIQTLGESNSGHTSTVWSLSFDASGDKMVS | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | 3prime_partial | 104 | 312-1(-) |
Amino Acid sequence : | |||
| MCFLQNSLTLERAFGVLFPDSYGFIAAAGSKYSWNTIDSGSRFPSDAPNLIGVAIKPLNLSQFKILILKIHSKNGGAVVANLCIAQLSGGVDRKIVQDSIRAAV | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | complete | 102 | 149-457(+) |
Amino Acid sequence : | |||
| MATPIRFGASLGNRLPESMVFQLYLLPAAAIKPYESGKRTPKALSSVRLFWRKHIHGLLDHVHGHRRANFWQQLALMPPLLFGKMLGLTLSVSPLWRVMTMK* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | 3prime_partial | 228 | 100-783(+) |
Amino Acid sequence : | |||
| MNFEDENFELREIQRLDGHTDKVWSVAWKPATGINGVPAVFASCSGDKTVRIWEEDSKGSFQCQAVLEETHTRTVRSCAWSPSGKFLATASFDATTAIWENVGVDFECVSTLEGHDNEVK SVSWNNSGSLLATCGRDKSVWIWEVLPGNEFDCVSVLQGHTQDVKMVQWNPSMDTLFSCSYDNTIKVWVEDGDSDDWHCIQTLGESNSGHTSTVWSLSFDASGDKMVS | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | 3prime_partial | 104 | 312-1(-) |
Amino Acid sequence : | |||
| MCFLQNSLTLERAFGVLFPDSYGFIAAAGSKYSWNTIDSGSRFPSDAPNLIGVAIKPLNLSQFKILILKIHSKNGGAVVANLCIAQLSGGVDRKIVQDSIRAAV | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334573.1 | complete | 102 | 149-457(+) |
Amino Acid sequence : | |||
| MATPIRFGASLGNRLPESMVFQLYLLPAAAIKPYESGKRTPKALSSVRLFWRKHIHGLLDHVHGHRRANFWQQLALMPPLLFGKMLGLTLSVSPLWRVMTMK* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,633.828 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.955 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.324 | ||