Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334577.1 | complete | 211 | 39-674(+) |
Amino Acid sequence : | |||
MALQLWEAVKESITAYTGLSPAAFFTAVAVAIALYQILSSLFGSNDAHVDHTSRKFEEEVKPPPPPVQLGEITDEELKQYDGSDSTKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKD ASRALAKMSFEEKDLNGDLTGLGVFELEALQDWEYKFMSKYVKVGTVKSTVPVTDAAANGEAAKVAEGSPSESASKETEETATDADAEKKD* | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 22,746.186 | ||
Theoretical pI: | 4.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 50.853 | ||
aromaticity | 0.090 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.223 | ||
sheet | 0.327 |