| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334585.1 | 3prime_partial | 253 | 27-785(+) |
Amino Acid sequence : | |||
| MMKSFAVKVEEGKKGENGEPSVGPVYRNPLSEHGYPAVDPNLSTVWDIFRSSAEKHSGNRMLGWRELVDGKWSPYKWKTYKEVYDEILQAGSALRGHGFEPGARIGIYGMNCPQWIVAME ACGAHSMVCVPLYDTLGPGAVNYILDHAEIDVVFVQDKKVKELLNPECKHAQRLKLVICFSSFTEEQKGKFNAAGTTTYSWTDFLKLGKEKPVEISPPKPSSICTIMYTSGTSGDPKGVI LTHENISXHIRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,954.683 | ||
| Theoretical pI: | 7.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48275 | ||
| Instability index: | 33.800 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.270 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334585.1 | 3prime_partial | 253 | 27-785(+) |
Amino Acid sequence : | |||
| MMKSFAVKVEEGKKGENGEPSVGPVYRNPLSEHGYPAVDPNLSTVWDIFRSSAEKHSGNRMLGWRELVDGKWSPYKWKTYKEVYDEILQAGSALRGHGFEPGARIGIYGMNCPQWIVAME ACGAHSMVCVPLYDTLGPGAVNYILDHAEIDVVFVQDKKVKELLNPECKHAQRLKLVICFSSFTEEQKGKFNAAGTTTYSWTDFLKLGKEKPVEISPPKPSSICTIMYTSGTSGDPKGVI LTHENISXHIRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,954.683 | ||
| Theoretical pI: | 7.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48275 | ||
| Instability index: | 33.800 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.270 | ||
| sheet | 0.222 | ||