| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334587.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TTLAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKK ACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESVKRDREGGHELEISVGKIDVNGFSAKQVSADY YFVPPYLYYGRITPNT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,582.288 | ||
| Theoretical pI: | 6.142 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 78840 79340 | ||
| Instability index: | 38.879 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.230 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334587.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TTLAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKK ACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESVKRDREGGHELEISVGKIDVNGFSAKQVSADY YFVPPYLYYGRITPNT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,582.288 | ||
| Theoretical pI: | 6.142 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 78840 79340 | ||
| Instability index: | 38.879 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.230 | ||
| sheet | 0.180 | ||