| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334590.1 | 3prime_partial | 234 | 72-773(+) |
Amino Acid sequence : | |||
| MSKQSHDVVVLMVPFPLQGHLNQLLHLSRLIAAREVPVHYVGTATHNRQARRRIQGWDPISTSNIIFHEFQPLSFISNPPDPDAPIKFPSHLQPLFDTLHLLRRPISGLLEDLSSRARRV IVIYDSLMGSVVQDFVRFPNAESYIFHSVSAYTIFFFLWETNGRPFPIEPEILSSLPSLEGCFTPEFLKFVVKQHKYLKLNSGRIYNTCRVVEGPFLEMLERPHISGNKKQWAL | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 12,045.026 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 80.494 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.678 | ||
Secondary Structure Fraction | |||
| Helix | 0.129 | ||
| turn | 0.483 | ||
| sheet | 0.147 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334590.1 | complete | 116 | 88-438(+) |
Amino Acid sequence : | |||
| MMWWCSWCPSLSRATSTSSSTSPASSLPAKSPSTTSAPPPTTARRGAGSKGGTQYPLPTSFSTNSNHSPSSPIPQTPTHQSSSHHTSNHYLTPCTYSAVPSAASWRISPPGPAESS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,045.026 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 80.494 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.678 | ||
Secondary Structure Fraction | |||
| Helix | 0.129 | ||
| turn | 0.483 | ||
| sheet | 0.147 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334590.1 | 3prime_partial | 234 | 72-773(+) |
Amino Acid sequence : | |||
| MSKQSHDVVVLMVPFPLQGHLNQLLHLSRLIAAREVPVHYVGTATHNRQARRRIQGWDPISTSNIIFHEFQPLSFISNPPDPDAPIKFPSHLQPLFDTLHLLRRPISGLLEDLSSRARRV IVIYDSLMGSVVQDFVRFPNAESYIFHSVSAYTIFFFLWETNGRPFPIEPEILSSLPSLEGCFTPEFLKFVVKQHKYLKLNSGRIYNTCRVVEGPFLEMLERPHISGNKKQWAL | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 12,045.026 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 80.494 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.678 | ||
Secondary Structure Fraction | |||
| Helix | 0.129 | ||
| turn | 0.483 | ||
| sheet | 0.147 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334590.1 | complete | 116 | 88-438(+) |
Amino Acid sequence : | |||
| MMWWCSWCPSLSRATSTSSSTSPASSLPAKSPSTTSAPPPTTARRGAGSKGGTQYPLPTSFSTNSNHSPSSPIPQTPTHQSSSHHTSNHYLTPCTYSAVPSAASWRISPPGPAESS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,045.026 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 80.494 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.678 | ||
Secondary Structure Fraction | |||
| Helix | 0.129 | ||
| turn | 0.483 | ||
| sheet | 0.147 | ||