Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334601.1 | complete | 162 | 167-655(+) |
Amino Acid sequence : | |||
MGSEHPDWLPLDWKVNVRIGSFGRKDKYYIHPPTGLTFNSKPQVLRYLSSPNSSNPKMDIKKTVAEKLPPGWIKEIRTKKKKGKTRRDPYYIDPVSGRQFRSMQEVFRYLKSNDSGKEES KLNDKGHKSTELVDNSQSDQMLLHRKKWKSILWGINIEKMIL* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,974.669 | ||
Theoretical pI: | 9.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 49.994 | ||
aromaticity | 0.093 | ||
GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.278 | ||
sheet | 0.167 |