Acc_NO	ORF type	length	start-end position (strand +/-)
>DY334606.1	complete	109	3-332(+)
Amino Acid sequence :
MGHPLEKRDLSFDDHGKKVLSMAPGLERLNILPFKVAAYDKTQNKMAFFDPSRAQDFVFISGTKMRNLAKNKESPPEGFMCPGGWEVLVEYYESLGVSDSGRVAEPVPA*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		12,135.764
Theoretical pI:		6.094
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		63.128
aromaticity		0.101
GRAVY		-0.416
Secondary Structure Fraction
Helix		0.275
turn		0.275
sheet		0.275