Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334613.1 | 5prime_partial | 265 | 816-19(-) |
Amino Acid sequence : | |||
FNAEFENPDTFQPAIEGCVGVFHVAHPIDFQSSETAEELTQKCVDATLGILRACIDSKTVKKFVYTSSISTVAVKEKLPDLLDEDVWSDVDFARKLGFTGSSYCISKTVTERAALEFGDK HCLDLVSVVPSFIHGPFVCPNLPGSVWSALALFLGNENHIKYQQITPLVHVDDVASAHIHLFEHPEAKGRYICNAIEVEFDDLCEFLKRRYPQFNMLNPESVLDKSIESKRISSKKLLES GFRYKYGLEEMYDEAIECCKKKLHV* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,062.612 | ||
Theoretical pI: | 7.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 37.730 | ||
aromaticity | 0.138 | ||
GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.330 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334613.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
YIYSYTQTCNFFLQHSIASSYISSSPYLYLKPLSNNFFDEILLLSIDLSNTDSGFSMLNCGYLLFRNSHKSSNSTSIALQIYLPFASGCSKRCICALATSSTCTNGVIC* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,062.612 | ||
Theoretical pI: | 7.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 37.730 | ||
aromaticity | 0.138 | ||
GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.330 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334613.1 | 5prime_partial | 265 | 816-19(-) |
Amino Acid sequence : | |||
FNAEFENPDTFQPAIEGCVGVFHVAHPIDFQSSETAEELTQKCVDATLGILRACIDSKTVKKFVYTSSISTVAVKEKLPDLLDEDVWSDVDFARKLGFTGSSYCISKTVTERAALEFGDK HCLDLVSVVPSFIHGPFVCPNLPGSVWSALALFLGNENHIKYQQITPLVHVDDVASAHIHLFEHPEAKGRYICNAIEVEFDDLCEFLKRRYPQFNMLNPESVLDKSIESKRISSKKLLES GFRYKYGLEEMYDEAIECCKKKLHV* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,062.612 | ||
Theoretical pI: | 7.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 37.730 | ||
aromaticity | 0.138 | ||
GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.330 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334613.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
YIYSYTQTCNFFLQHSIASSYISSSPYLYLKPLSNNFFDEILLLSIDLSNTDSGFSMLNCGYLLFRNSHKSSNSTSIALQIYLPFASGCSKRCICALATSSTCTNGVIC* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,062.612 | ||
Theoretical pI: | 7.724 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 37.730 | ||
aromaticity | 0.138 | ||
GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.330 | ||
sheet | 0.193 |