| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334640.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| GFKMSNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLDYASPVTEVEMEQLQKQKERIKTLLAQTPDDSVLKIELIDAIQRLGVGYHFGKEINHSLRQIYNTFQISSKDNDVRVVAL RFRLLRQHGYPVPSDVFKKFIDNQGKLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLEPLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLDFNI LQKIHQEELTH | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,932.501 | ||
| Theoretical pI: | 5.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 47.737 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.203 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334640.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| GFKMSNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLDYASPVTEVEMEQLQKQKERIKTLLAQTPDDSVLKIELIDAIQRLGVGYHFGKEINHSLRQIYNTFQISSKDNDVRVVAL RFRLLRQHGYPVPSDVFKKFIDNQGKLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLEPLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLDFNI LQKIHQEELTH | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,932.501 | ||
| Theoretical pI: | 5.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 47.737 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.203 | ||
| sheet | 0.279 | ||