| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334642.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| SHTLTELAANILSVPGKMVCVTGAGGYIASWLVKLLLEKGYTVRGTVRNPDDPKNSHLRELEGADERLILCRADLNIYESLREAINGCNGVFHTASPVTDDPEQMLEPALEGAKNVIRAA AEAKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKTVAEQAAWETARELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIQAYVDVKDVAL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 26,089.536 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35785 | ||
| Instability index: | 26.277 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.213 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334642.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| SHTLTELAANILSVPGKMVCVTGAGGYIASWLVKLLLEKGYTVRGTVRNPDDPKNSHLRELEGADERLILCRADLNIYESLREAINGCNGVFHTASPVTDDPEQMLEPALEGAKNVIRAA AEAKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKTVAEQAAWETARELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIQAYVDVKDVAL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 26,089.536 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35785 | ||
| Instability index: | 26.277 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.213 | ||
| sheet | 0.297 | ||