| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334643.1 | internal | 288 | 3-866(+) |
Amino Acid sequence : | |||
| FILPPLSSTNTPPHFSHSHSPSMASTAASPAFCAIPKASTAARASFNAPTTRFLPKTPVRHLGFAAPDPLTHLVATKLRSFGGSSAKPVRGVATMAKKSVGDLSAADFKGKKVFVRADLN VPLDDNQNITDDTRIRAAIPTIKHLINNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAGLSEGSVLLLENVRFYKEEEKNEPEFAKKLASLADLFVN DAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLDGAVKSPKRPFA | |||
Physicochemical properties | |||
| Number of amino acids: | 288 | ||
| Molecular weight: | 30,763.077 | ||
| Theoretical pI: | 9.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 32.421 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.264 | ||
| sheet | 0.278 | ||