| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334647.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| RXEGTRRRCTVRSQVKRIVDTLRIPFDDVDRSAGVAEPSICVFAVGMDGWDFMPFDRSPCHLLLLQPPLSGSGTPRSTRPSPSPLSRHGLSHTRKQMGEILWWRGSICGVLWCCCWMHSF GWTMHQGNILAVKARWKHETLRIRDNIWRADDNFSSNPIFPLVEAHQLGFFASIPYLQCMRYCCFYLYWELIQGASKRLFSQGQPTKLGHLISLL | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 22,747.355 | ||
| Theoretical pI: | 9.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
| Instability index: | 36.896 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.258 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334647.1 | 5prime_partial | 210 | 3-635(+) |
Amino Acid sequence : | |||
| GXKELDAGAQFVLKSRGSWIHCGYHLTTSIVAPALLSLPYAFSLLGWTAGILCLLIGALVTFYSYNLLSLVLEHHAQLGHRHLRFRDMAYHILGSRWGKYYGGGVQFVVCYGAVVGCTLL GGQCIKAIYLLSRPDGSMKLYEFVIIFGGLMTILAQIPSFHSLRHINLVSLLLSLTYSACATAASIYIGSSSKGPAKDYSLRGNPRNSDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 22,747.355 | ||
| Theoretical pI: | 9.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
| Instability index: | 36.896 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.258 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334647.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| RXEGTRRRCTVRSQVKRIVDTLRIPFDDVDRSAGVAEPSICVFAVGMDGWDFMPFDRSPCHLLLLQPPLSGSGTPRSTRPSPSPLSRHGLSHTRKQMGEILWWRGSICGVLWCCCWMHSF GWTMHQGNILAVKARWKHETLRIRDNIWRADDNFSSNPIFPLVEAHQLGFFASIPYLQCMRYCCFYLYWELIQGASKRLFSQGQPTKLGHLISLL | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 22,747.355 | ||
| Theoretical pI: | 9.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
| Instability index: | 36.896 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.258 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334647.1 | 5prime_partial | 210 | 3-635(+) |
Amino Acid sequence : | |||
| GXKELDAGAQFVLKSRGSWIHCGYHLTTSIVAPALLSLPYAFSLLGWTAGILCLLIGALVTFYSYNLLSLVLEHHAQLGHRHLRFRDMAYHILGSRWGKYYGGGVQFVVCYGAVVGCTLL GGQCIKAIYLLSRPDGSMKLYEFVIIFGGLMTILAQIPSFHSLRHINLVSLLLSLTYSACATAASIYIGSSSKGPAKDYSLRGNPRNSDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 22,747.355 | ||
| Theoretical pI: | 9.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
| Instability index: | 36.896 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.258 | ||
| sheet | 0.268 | ||