Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334649.1 | complete | 201 | 62-667(+) |
Amino Acid sequence : | |||
MADPQGLEGNQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQNIV GSCDVKFPIRLEGLAYAHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKVRDETYTAFENIYPVLTEFRKVQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,420.058 | ||
Theoretical pI: | 9.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 36.894 | ||
aromaticity | 0.090 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.199 | ||
sheet | 0.254 |