| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334656.1 | 5prime_partial | 244 | 754-20(-) |
Amino Acid sequence : | |||
| EEEERKDFMQTIVDHLQDEDNNKSLGMLQIKAMLVNIIIGGTDTTSTAIEWVMTELLHHPKVMEKVQQELDEVVGPNNIVEESHIGKLVYLDAVLKETMRVPPIGPLMPRTPNKNCTVGG YTIPKDSSVFVNIWSIHRDPAVWENPSEFRPERFLVGNETDKWEFSGTNLNYIPFGSGRRVCAGLPLAEIMLKYITASLLHSFQWRLCDGEELDISDEIVSTLRKRIPLVAIPIPRLASF DLYH* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,752.550 | ||
| Theoretical pI: | 5.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 43.457 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.230 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334656.1 | 5prime_partial | 244 | 754-20(-) |
Amino Acid sequence : | |||
| EEEERKDFMQTIVDHLQDEDNNKSLGMLQIKAMLVNIIIGGTDTTSTAIEWVMTELLHHPKVMEKVQQELDEVVGPNNIVEESHIGKLVYLDAVLKETMRVPPIGPLMPRTPNKNCTVGG YTIPKDSSVFVNIWSIHRDPAVWENPSEFRPERFLVGNETDKWEFSGTNLNYIPFGSGRRVCAGLPLAEIMLKYITASLLHSFQWRLCDGEELDISDEIVSTLRKRIPLVAIPIPRLASF DLYH* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,752.550 | ||
| Theoretical pI: | 5.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 43.457 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.230 | ||
| sheet | 0.258 | ||