| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334661.1 | 3prime_partial | 236 | 39-746(+) |
Amino Acid sequence : | |||
| MQLAIENFEFQQSIYIQELEELKGWSKKWRLSEMGFGREKSGYTYFAVASCSCLPHNSIMRLVIAKAAIIVTVADDFYDMEGSLPDLEILTNAVRRWDGEGLEGHSKTIFDALDGFVNDI VAKCHSQQASVVLSKLQNLWRESFEAWMLERRWSITGHLPSMDEYLETGMTSIAAHTIALPATTFLSQTGPNGQYETITKLLMAITRLANDMQSYQKEAADGKMNMVLLHRQKHEN | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,554.274 | ||
| Theoretical pI: | 8.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 60.149 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.265 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334661.1 | 5prime_partial | 102 | 746-438(-) |
Amino Acid sequence : | |||
| VFMFLPVEQHHIHFPVCCFFLITLHVVGQTGDSHEQFGDGFILSIGSSLAQESGGWKSNRVCRNRCHSGFKVFIHGWQMPCYAPSSLQHPRLKAFSPKILQL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,554.274 | ||
| Theoretical pI: | 8.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 60.149 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.265 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334661.1 | 3prime_partial | 236 | 39-746(+) |
Amino Acid sequence : | |||
| MQLAIENFEFQQSIYIQELEELKGWSKKWRLSEMGFGREKSGYTYFAVASCSCLPHNSIMRLVIAKAAIIVTVADDFYDMEGSLPDLEILTNAVRRWDGEGLEGHSKTIFDALDGFVNDI VAKCHSQQASVVLSKLQNLWRESFEAWMLERRWSITGHLPSMDEYLETGMTSIAAHTIALPATTFLSQTGPNGQYETITKLLMAITRLANDMQSYQKEAADGKMNMVLLHRQKHEN | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,554.274 | ||
| Theoretical pI: | 8.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 60.149 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.265 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334661.1 | 5prime_partial | 102 | 746-438(-) |
Amino Acid sequence : | |||
| VFMFLPVEQHHIHFPVCCFFLITLHVVGQTGDSHEQFGDGFILSIGSSLAQESGGWKSNRVCRNRCHSGFKVFIHGWQMPCYAPSSLQHPRLKAFSPKILQL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,554.274 | ||
| Theoretical pI: | 8.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 60.149 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.265 | ||
| sheet | 0.167 | ||